PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4579030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 212aa    MW: 23747.3 Da    PI: 10.1993
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4579030.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.92.2e-5690181293
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                      reqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+
  Lj1g3v4579030.1  90 REQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREV 181
                      89****************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-5286181IPR009072Histone-fold
SuperFamilySSF471131.86E-3892182IPR009072Histone-fold
PfamPF008085.2E-2895159IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.3E-20123141No hitNo description
PROSITE patternPS006850126142IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.3E-20142160No hitNo description
PRINTSPR006152.3E-20161179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MLVGKNIRKR TVVIGLSLRS QRLLLTFFSS VRFLSLHSHR SHLTHSLSLA PNTNSQIRVP  60
STTMSDGPTS PGAGGSHDSG GDHSPRSNIR EQDRYLPIAN ISRIMKKALP ANGKIAKDAK  120
ETVQECVSEF ISFITSEASD KCQREKRKTI NGDDLLWAMA TLGFEDYIDP LKIYLTRYRE  180
VISIFQFTVF FLVPSNYHHV LQTLSVLGPL TM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4889180192Transcription factor HapC (Eurofung)
4g92_B3e-4889180192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.199862e-81floral bud| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0102911e-134AP010291.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT58D09, TM2058, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162720.14e-80hypothetical protein PHAVU_001G174600g, partial
SwissprotQ8VYK41e-69NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0B2PJ972e-89A0A0B2PJ97_GLYSO; Nuclear transcription factor Y subunit B-8 (Fragment)
STRINGGLYMA19G36220.23e-87(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.84e-64nuclear factor Y, subunit B1